Proteintech, 66396-1-Ig, NF-M Monoclonal antibody

Size: 20ul / 150ul The NF-M (66396-1-Ig) by Proteintech is a Monoclonal antibody targeting NF-M in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 66396-1-Ig targets NF-M in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, rat brain, mouse brain tissue, PC-12 cells Positive IHC detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: SH-SY5Y cells Positive FC (Intra) detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:20000 Immunohistochemistry (IHC): IHC : 1:200-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information NEFM, also named as NEF3 and NFM, belongs to the intermediate filament family. Neurofilaments are the 10 nm intermediate filaments found specifically in neurons. They are a major component of the cell's cytoskeleton, and provide support for normal axonal radial growth. Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber. The names given to the three major neurofilament subunits are based upon the apparent molecular weight of the mammalian subunits on SDS-PAGE: NF-L, 65-68 kDa; NF-M,140-160 kDa and NF-H, 200-220 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag22709 Product name: Recombinant human NEFM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC002421 Sequence: MSYTLDSLGNPSAYRRVTETRSSFSRVSGSPSSGFRSQSWSRGSPSTVSSSYKRSMLAPRLAYSSAMLSSAESSLDFSQSSSLLNGGSGPGGDYKLS Predict reactive species Full Name: neurofilament, medium polypeptide Calculated Molecular Weight: 102 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC002421 Gene Symbol: NF-M Gene ID (NCBI): 4741 RRID: AB_2881770 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P07197 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.