Proteintech, 66397-1-Ig, PLA2G1B Monoclonal antibody

Size: 20ul / 150ul The PLA2G1B (66397-1-Ig) by Proteintech is a Monoclonal antibody targeting PLA2G1B in WB, IHC, ELISA applications with reactivity to human, pig samples 66397-1-Ig targets PLA2G1B in WB, IHC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig pancreas tissue Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information PLA2G1B is a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. PLA2G1B catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8812 Product name: Recombinant human PLA2G1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-70 aa of BC005386 Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV Predict reactive species Full Name: phospholipase A2, group IB (pancreas) Calculated Molecular Weight: 70aa,8 kDa; 148aa,16 kDa Observed Molecular Weight: 13-16 kDa GenBank Accession Number: BC005386 Gene Symbol: PLA2G1B Gene ID (NCBI): 5319 RRID: AB_2881771 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04054 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.