Iright
BRAND / VENDOR: Proteintech

Proteintech, 66403-1-Ig, PSMB10 Monoclonal antibody

CATALOG NUMBER: 66403-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PSMB10 (66403-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMB10 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 66403-1-Ig targets PSMB10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: Raji cells, Ramos cells, U-937 cells, rat thymus tissue, human spleen tissue, pig thymus tissue Positive IHC detected in: human liver cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information SMB10(Proteasome subunit beta type-10) is also named as LMP10, MECL1.It belongs to the peptidase T1B family and is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8835 Product name: Recombinant human PSMB10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-273 aa of BC017198 Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE Predict reactive species Full Name: proteasome (prosome, macropain) subunit, beta type, 10 Calculated Molecular Weight: 273 aa, 29 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC017198 Gene Symbol: PSMB10 Gene ID (NCBI): 5699 RRID: AB_2881777 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P40306 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924