Proteintech, 66409-1-Ig, SCP3 Monoclonal antibody

Size: 20ul / 150ul The SCP3 (66409-1-Ig) by Proteintech is a Monoclonal antibody targeting SCP3 in WB, ELISA applications with reactivity to human samples 66409-1-Ig targets SCP3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue, DU 145 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information SYCP3 is an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. SYCP3 is required for centromere pairing during meiosis in male germ cells. SYCP3 is also required for normal meiosis during spermatogenesis and male fertility. Mutations in SYCP3 are associated with azoospermia in males and susceptibility to pregnancy loss in females. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19330 Product name: Recombinant human SYCP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-236 aa of BC062662 Sequence: GKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF Predict reactive species Full Name: synaptonemal complex protein 3 Calculated Molecular Weight: 236 aa, 28 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC062662 Gene Symbol: SYCP3 Gene ID (NCBI): 50511 RRID: AB_2881781 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8IZU3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.