Product Description
Size: 20ul / 150ul
The AGTR1 (66415-1-Ig) by Proteintech is a Monoclonal antibody targeting AGTR1 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples
66415-1-Ig targets AGTR1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Applications
Positive WB detected in: pig heart tissue, pig skeletal muscle tissue, rat heart tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Background Information
Angiotensin II (Ang II), the main effector molecule of the renin-angiotensin system, exerts its actions mainly via interaction with type-1 angiotensin II receptor (AGTR1, also named as AT1R), thereby contributing to blood pressure regulation. AGTR1 mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. By regulating vascular tone, cardiovascular function, salt and water homeostasis, AGTR1 exerts an indispensable physiological role (PMID: 21600887). AGTR1 has been implicated in diverse aspects of human disease, from the regulation of blood pressure and cardiovascular homeostasis to cancer progression (PMID: 26975580).
Specification
Tested Reactivity: human, mouse, rat, pig
Cited Reactivity: human, mouse
Host / Isotype: Mouse / IgG2a
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag14461 Product name: Recombinant human AGTR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 290-359 aa of BC022447 Sequence: IAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE Predict reactive species
Full Name: angiotensin II receptor, type 1
Calculated Molecular Weight: 359 aa, 41 kDa
Observed Molecular Weight: 50 kDa
GenBank Accession Number: BC022447
Gene Symbol: AGTR1
Gene ID (NCBI): 185
RRID: AB_2881787
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P30556
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924