Proteintech, 66427-1-Ig, STAT5B Monoclonal antibody

Size: 20ul / 150ul The STAT5B (66427-1-Ig) by Proteintech is a Monoclonal antibody targeting STAT5B in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 66427-1-Ig targets STAT5B in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells Positive IF/ICC detected in: HeLa cells, HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension Background Information STAT5B belongs to the transcription factor STAT family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT5B carries out a dual function: signal transduction and activation of transcription. STAT5B mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different GH. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. Despite the 95% homology between the immunogen (Ag2709) and the STAT5A protein, our WB detection showed that this antibody does not recognize the STAT5A fusion protein (Ag19546). Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2709 Product name: Recombinant human STAT5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC020868 Sequence: MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAAT Predict reactive species Full Name: signal transducer and activator of transcription 5B Calculated Molecular Weight: 787 aa, 90 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC020868 Gene Symbol: STAT5B Gene ID (NCBI): 6777 ENSEMBL Gene ID: ENSG00000173757 RRID: AB_2881798 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P51692 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.