Iright
BRAND / VENDOR: Proteintech

Proteintech, 66434-1-Ig, GDI1 Monoclonal antibody

CATALOG NUMBER: 66434-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GDI1 (66434-1-Ig) by Proteintech is a Monoclonal antibody targeting GDI1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 66434-1-Ig targets GDI1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: Saos-2 cells, HEK-293 cells, mouse brain tissue, Neuro-2a cells, pig brain tissue, rat brain tissue, U-251 cells, rabbit brain tissue, PANC-1 cells, MCF-7 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family. GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI1 is expressed primarily in neural and sensory tissues and also in secretory cells, displaying a diffuse, cytoplasmic distribution in cells. It runs as a 55 kDa protein in SDS-PAGE. (PMID: 7929030,PMID: 19570034) Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17511 Product name: Recombinant human GDI1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-209 aa of BC000317 Sequence: MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRI Predict reactive species Full Name: GDP dissociation inhibitor 1 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC000317 Gene Symbol: GDI1 Gene ID (NCBI): 2664 RRID: AB_2881804 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P31150 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924