Proteintech, 66438-1-Ig, PEBP1/RKIP Monoclonal antibody

Size: 20ul / 150ul The PEBP1/RKIP (66438-1-Ig) by Proteintech is a Monoclonal antibody targeting PEBP1/RKIP in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 66438-1-Ig targets PEBP1/RKIP in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, Neuro-2a cells, PC-12 cells, rat brain tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Raf kinase inhibitor protein (RKIP), also termed phosphatidylethanolamine binding protein PEBP1, was initially identified as a potent inhibitor of Raf-1/MEK/ERK, NF-kB, and G-protein-coupled receptor signaling pathways. Later RKIP has been further identified as a metastasis suppressor and its loss of expression has been reported in various cancers. Its expression has been proposed as a prognostic marker for patients diagnosed with the above cancers. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0864 Product name: Recombinant human PEBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 83-187 aa of BC008714 Sequence: EWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK Predict reactive species Full Name: phosphatidylethanolamine binding protein 1 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 23-27 kDa GenBank Accession Number: BC008714 Gene Symbol: PEBP1 Gene ID (NCBI): 5037 RRID: AB_2881808 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P30086 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.