Iright
BRAND / VENDOR: Proteintech

Proteintech, 66445-1-Ig, Gamma Catenin Monoclonal antibody

CATALOG NUMBER: 66445-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Gamma Catenin (66445-1-Ig) by Proteintech is a Monoclonal antibody targeting Gamma Catenin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, canine samples 66445-1-Ig targets Gamma Catenin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, canine samples. Tested Applications Positive WB detected in: human heart tissue, A431 cells, HT-29 cells, MDCK cells, rat heart tissue, T-47D cells Positive IHC detected in: human breast cancer tissue, human skin tissue, human stomach cancer tissue, mouse stomach tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Plakoglobin (γ-catenin), a member of the Armadillo proteins, plays important roles in cell adhesion with α-catenin and β-catenin, is involved in Wnt signaling, and is translocated into the nucleus and binds LEF1. Plakoglobin is a major cytoplasmic component of both desmosomes and adherens junctions, and is the only known constituent common to submembranous plaques in both of these structures, which are located at the intercalated disc (ICD) of cardiomyocytes. Plakoglobin links cadherins to the actin cytoskeleton. Mutations in plakoglobin are associated with arrhythmogenic right ventricular dysplasia and Pemphigus vulgaris. Specification Tested Reactivity: human, mouse, rat, pig, canine Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1627 Product name: Recombinant human JUP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 396-745 aa of BC011865 Sequence: LVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDLDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA Predict reactive species Full Name: junction plakoglobin Calculated Molecular Weight: 82 kDa Observed Molecular Weight: 82 kDa GenBank Accession Number: BC011865 Gene Symbol: Gamma Catenin Gene ID (NCBI): 3728 RRID: AB_2881814 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P14923 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924