Proteintech, 66455-1-Ig, EGFR Monoclonal antibody

Size: 20ul / 150ul The EGFR (66455-1-Ig) by Proteintech is a Monoclonal antibody targeting EGFR in WB, IHC, ELISA applications with reactivity to human samples 66455-1-Ig targets EGFR in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, EC109 cells, A549 cells, HeLa cells, HepG2 cells, LNCaP cells, PC-3 cells, SKOV-3 cells, MDA-MB-468 cells, MDA-MB-231 cells, PC-3 clles Positive IHC detected in: human tonsillitis tissue, human breast cancer tissue, human cervical cancer tissue, human colon cancer tissue, human gliomas tissue, human lung cancer tissue, human placenta tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Background Information EGFR, also named as ERBB1, is a cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. The gene resides on chromosome 7p12, encoding a 170 kDa membrane-associated glycoprotein. Recent studies have shown EGFR plays a critical role in cancer development and progression, including cell proliferation, apoptosis, angiogenesis, and metastatic spread. Mutations in this gene are associated with lung cancer. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24947 Product name: Recombinant human EGFR protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 291-534 aa of BC094761 Sequence: VCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNC Predict reactive species Full Name: epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) Calculated Molecular Weight: 1210 aa, 134 kDa Observed Molecular Weight: 145-180 kDa GenBank Accession Number: BC094761 Gene Symbol: EGFR Gene ID (NCBI): 1956 RRID: AB_2881824 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P00533 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.