Product Description
Size: 20ul / 150ul
The GABARAPL1 (66458-1-Ig) by Proteintech is a Monoclonal antibody targeting GABARAPL1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples
66458-1-Ig targets GABARAPL1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue, pig brain tissue
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200
Background Information
GABARAPL1 (GABARAP-like protein 1), also named ATG8, GEC1, APG8L, ATG8L, and APG8-LIKE, is a member of the GABARP (GABAA receptor-associated protein) family. GABARAPL1 was initially identified as an estrogen-regulated gene and the protein acts in receptor and vesicle transport. It's also involved in the process of autophagy like GABARAP and GABARAPL2 and may be considered as an autophagic marker. It is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle and at very low levels in the thymus and small intestine.
Specification
Tested Reactivity: human, mouse, rat, pig
Cited Reactivity: human
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag1473 Product name: Recombinant human ATG8L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC009309 Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK Predict reactive species
Full Name: GABA(A) receptor-associated protein like 1
Calculated Molecular Weight: 14 kDa
Observed Molecular Weight: 16-18 kDa
GenBank Accession Number: BC009309
Gene Symbol: GABARAPL1
Gene ID (NCBI): 23710
RRID: AB_2881827
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: Q9H0R8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924