Iright
BRAND / VENDOR: Proteintech

Proteintech, 66463-1-Ig, CAMSAP2 Monoclonal antibody

CATALOG NUMBER: 66463-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CAMSAP2 (66463-1-Ig) by Proteintech is a Monoclonal antibody targeting CAMSAP2 in WB, ELISA applications with reactivity to human, mouse, rat samples 66463-1-Ig targets CAMSAP2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, PC-3 cells, rat brain tissue, HeLa cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CAMSAP2, also known as CAMSAP1L1, is a microtubule minus-end binding protein, and is required for proper microtubule organization in neurons. CAMSAP2 stabilizes noncentrosomal microtubules and is important for neuronal polarity, axon specification, and dendritic branch formation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11794 Product name: Recombinant human CAMSAP1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 551-904 aa of BC065508 Sequence: KADVPVEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQLEAEMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQVVKQKKQRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEGFLSPSRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA Predict reactive species Full Name: calmodulin regulated spectrin-associated protein 1-like 1 Calculated Molecular Weight: 1478 aa, 167 kDa Observed Molecular Weight: 170-200 kDa GenBank Accession Number: BC065508 Gene Symbol: CAMSAP2 Gene ID (NCBI): 23271 RRID: AB_2881831 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q08AD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924