Iright
BRAND / VENDOR: Proteintech

Proteintech, 66483-1-Ig, Cytokeratin 7 Monoclonal antibody

CATALOG NUMBER: 66483-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Cytokeratin 7 (66483-1-Ig) by Proteintech is a Monoclonal antibody targeting Cytokeratin 7 in WB, IHC, IF-P, ELISA applications with reactivity to Human samples 66483-1-Ig targets Cytokeratin 7 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, A431 cells, T-47D cells, PC-3 cells, HeLa cells, HepG2 cells, BxPC-3 cells Positive IHC detected in: human lung cancer tissue, human ovary tumor tissue, human kidney tissue, human pancreas tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human prostate cancer tissue Recommended dilution Western Blot (WB): WB : 1:10000-1:40000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. KRT7, also named as cytokeratin 7, is one member of type II basic cytokeratin. It is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels, and their neoplasms. KRT7 is marker of epithelial tissues, but not present in carcinomas of stratified squamous cell origin.This antibody is specifically against KRT7. Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7895 Product name: Recombinant human CK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC002700 Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDAR Predict reactive species Full Name: keratin 7 Calculated Molecular Weight: 469 aa, 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC002700 Gene Symbol: Cytokeratin 7 Gene ID (NCBI): 3855 RRID: AB_2881849 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P08729 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924