Iright
BRAND / VENDOR: Proteintech

Proteintech, 66488-1-Ig, VAMP3/Cellubrevin Monoclonal antibody

CATALOG NUMBER: 66488-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VAMP3/Cellubrevin (66488-1-Ig) by Proteintech is a Monoclonal antibody targeting VAMP3/Cellubrevin in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 66488-1-Ig targets VAMP3/Cellubrevin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue, HEK-293 cells, rat brain tissue, mouse brain tissue Positive IF/ICC detected in: Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunofluorescence (IF)/ICC: IF/ICC : 1:900-1:3600 Background Information VAMP3, also named cellubrevin or synaptobrevin 3, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP3 is a v-SNARE (soluble NSF-attachment protein receptor). Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP3 resides in recycling endosomes and endosome-derived transport vesicles, involved in regulating membrane traffic. It is implicated in recycling of transferrin receptors, secretion of alpha-granules in platelets, and membrane trafficking during cell migration. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1156 Product name: Recombinant human VAMP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC005941 Sequence: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCEMWAIGITVLVIFIIIIIVWVVS Predict reactive species Full Name: vesicle-associated membrane protein 3 (cellubrevin) Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC005941 Gene Symbol: VAMP3 Gene ID (NCBI): 9341 RRID: AB_2881853 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15836 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924