Proteintech, 66489-1-Ig, S100A4 Monoclonal antibody

Size: 20ul / 150ul The S100A4 (66489-1-Ig) by Proteintech is a Monoclonal antibody targeting S100A4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 66489-1-Ig targets S100A4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NK-92 cells, A375 cells, HeLa cells, PC-3 cells, THP-1 cells, A549 cells, NIH/3T3 cells, HSC-T6 cells Positive IHC detected in: human lung cancer tissue, human colon cancer tissue, human tonsillitis tissue, K-562 cells, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information S100A4 is a member of the S100 family of calcium-binding proteins. The S100 family members have been involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A4 is known to localize to and function in the nucleus, cytoplasm of cells, and the extracellular space. S100A4 has also been shown to be associated with tumor growth, motility, invasion, metastasis, angiogenesis, apoptosis, and chemoresistance. It is a fibroblast-specific protein associated with mesenchymal cell morphology and motility, is expressed during epithelial-mesenchymal transformations (EMT) in vivo (PMID: 9362334). It is a specific prognostic marker for renal survival in patients with IgAN (PMID: 16105038). It is also an improved marker for lung fibroblasts that could be useful for investigating the pathogenesis of pulmonary fibrosis(PMID: 15618458). Overexpression of S100A4 is correlated with a worse prognosis inpatients with various types of cancer. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9019 Product name: Recombinant human S100A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC016300 Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK Predict reactive species Full Name: S100 calcium binding protein A4 Calculated Molecular Weight: 101 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC016300 Gene Symbol: S100A4 Gene ID (NCBI): 6275 ENSEMBL Gene ID: ENSG00000196154 RRID: AB_2881854 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26447 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.