Proteintech, 66525-1-Ig, HMGB1 Monoclonal antibody

Size: 20ul / 150ul The HMGB1 (66525-1-Ig) by Proteintech is a Monoclonal antibody targeting HMGB1 in WB, ELISA applications with reactivity to human, mouse samples 66525-1-Ig targets HMGB1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, L02 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information The HMG (high mobility group) proteins are nonhistone chromosomal proteins that is present in almost all eukaryotic cells, and it functions to stabilize NUCLEOSOME formation and acts as a transcription-factor-like protein that regulates the expression of several genes[PMID: 18160415]. Once injury, infection or other inflammatory stimuli, activated macrophages, mature dendritic cells and natural killer cells can secret HMGB1, which act as a crucial cytokine[PMID: 20163887]. HMGB1 also involved in V(D)J recombination by acting as a cofactor of the RAG complex, stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS)[PMID: 19360789 ]. Act as a Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. HMGB1 (high mobility group box 1) modulates gene expression in the nucleus, but certain immune cells secrete HMGB1 as an extracellular Alarmin to signal tissue damage.The nuclear HMGB1 relocalizes to the extracellular milieu in senescent human and mouse cells in culture and in vivo, which stimulated cytokine secretion through TLR-4 signaling (23649808).This antibody is raised against full length HMGB1 of human origin. The monomeric HMGB1 is 29 kDa and dimer is 58 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1264 Product name: Recombinant human HMGB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC003378 Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE Predict reactive species Full Name: high-mobility group box 1 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC003378 Gene Symbol: HMGB1 Gene ID (NCBI): 3146 RRID: AB_2881888 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P09429 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.