Proteintech, 66527-1-Ig, MFF Monoclonal antibody

Size: 20ul / 150ul The MFF (66527-1-Ig) by Proteintech is a Monoclonal antibody targeting MFF in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 66527-1-Ig targets MFF in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue, L02 cells, HepG2 cells, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information MFF (mitochondrial fission factor) is a mitochondrial outer membrane protein that is involved in mitochondrial localization of Drp1 and mitochondrial fission. Multiple isoforms of MFF exist due to the alternative splicing. This antibody recognizes the endogenous MFF protein around 26-29 kDa and 35-38 kDa. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9990 Product name: Recombinant human MFF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC000797 Sequence: MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR Predict reactive species Full Name: mitochondrial fission factor Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 35-38 kDa GenBank Accession Number: BC000797 Gene Symbol: MFF Gene ID (NCBI): 56947 RRID: AB_2881890 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9GZY8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.