Iright
BRAND / VENDOR: Proteintech

Proteintech, 66531-1-Ig, MRPL45 Monoclonal antibody

CATALOG NUMBER: 66531-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MRPL45 (66531-1-Ig) by Proteintech is a Monoclonal antibody targeting MRPL45 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 66531-1-Ig targets MRPL45 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HSC-T6 cells, RAW 264.7 cells, HEK-293 cells, Jurkat cells, HepG2 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2500-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL45 is a 39S subunit protein. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8207 Product name: Recombinant human MRPL45 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 86-329 aa of BC006235 Sequence: AGLVIPPEKSDRSIHLACTAGIFDAYVPPEGDARISSLSKEGLIERTERMKKTMASQVSIRRIKDYDANFKIKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTEHCFPDMTWDIKYKTVRWSFVESLEPSHVVQVRCSSMMNQGNVYGQITVRMHTRQTLAIYDRFGRLMYGQEDVPKDVLEYVVFEKQLTNPYGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPEEEYEEAQGEAQKPQLA Predict reactive species Full Name: mitochondrial ribosomal protein L45 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC006235 Gene Symbol: MRPL45 Gene ID (NCBI): 84311 RRID: AB_2881894 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BRJ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924