Proteintech, 66532-1-Ig, ACOT9 Monoclonal antibody

Size: 20ul / 150ul The ACOT9 (66532-1-Ig) by Proteintech is a Monoclonal antibody targeting ACOT9 in WB, IHC, ELISA applications with reactivity to Human, Rat, mouse samples 66532-1-Ig targets ACOT9 in WB, IHC, ELISA applications and shows reactivity with Human, Rat, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, RAW 264.7 cells, Jurkat cells, HSC-T6 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ACOT9 (Acyl-coenzyme A thioesterase 9) is a member of the acyl-CoA thioesterase superfamily, which is a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. ACOT9 has 4 isoforms with the molecular mass of 43-50 kDa. Specification Tested Reactivity: Human, Rat, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8884 Product name: Recombinant human ACOT9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-212 aa of BC012573 Sequence: MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG Predict reactive species Full Name: acyl-CoA thioesterase 9 Calculated Molecular Weight: 24 kDa, 49 kDa Observed Molecular Weight: 43-50 kDa GenBank Accession Number: BC012573 Gene Symbol: ACOT9 Gene ID (NCBI): 23597 RRID: AB_2881895 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y305 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.