Iright
BRAND / VENDOR: Proteintech

Proteintech, 66536-1-Ig, AMPK Alpha 1 Monoclonal antibody

CATALOG NUMBER: 66536-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AMPK Alpha 1 (66536-1-Ig) by Proteintech is a Monoclonal antibody targeting AMPK Alpha 1 in WB, IHC, ELISA applications with reactivity to Human, Rat, Mouse samples 66536-1-Ig targets AMPK Alpha 1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with Human, Rat, Mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, HEK-293 cells, A549 cells, HepG2 cells, K-562 cells, PC-12 cells, L02 cells, HT-29 cells, THP-1 cells, 4T1 cells, MCF-7 cells Positive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The mammalian 5-prime-AMP-activated protein kinase (AMPK) appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. PRKAA1 is also named as AMPK1, ACACA kinase, HMGCR kinase. It is a mammalian homologue of sucrose non-fermenting protein kinase (SNF-1), which belongs to a serine/threonine protein kinase family. It has 2 isoforms with molecular mass of 63-66 kDa produced by alternative splicing. Specification Tested Reactivity: Human, Rat, Mouse Cited Reactivity: human, mouse, rat, pig, hamster, goat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24744 Product name: Recombinant human AMPK alpha protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-207 aa of BC012622 Sequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH Predict reactive species Full Name: protein kinase, AMP-activated, alpha 1 catalytic subunit Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC012622 Gene Symbol: AMPK Alpha 1 Gene ID (NCBI): 5562 RRID: AB_2881899 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13131 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924