Proteintech, 66540-1-Ig, Calponin 1 Monoclonal antibody

Size: 20ul / 150ul The Calponin 1 (66540-1-Ig) by Proteintech is a Monoclonal antibody targeting Calponin 1 in WB, IHC, ELISA applications with reactivity to human samples 66540-1-Ig targets Calponin 1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human heart tissue, human vein tissue, human colon tissue, human ileum tissue, human bladder tissue, human kidney tissue Positive IHC detected in: human myofibroblastoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1500-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kD protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation. This antibody raised against the specific region of human CNN1, thus it does not cross-react with CNN2 or CNN3. Specification Tested Reactivity: human Cited Reactivity: mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21384 Product name: Recombinant human Calponin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-265 aa of BC022015 Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR Predict reactive species Full Name: calponin 1, basic, smooth muscle Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33-35 kDa GenBank Accession Number: BC022015 Gene Symbol: Calponin Gene ID (NCBI): 1264 RRID: AB_2881902 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P51911 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.