Proteintech, 66543-1-Ig, SIRT4 Monoclonal antibody

Size: 20ul / 150ul The SIRT4 (66543-1-Ig) by Proteintech is a Monoclonal antibody targeting SIRT4 in WB, ELISA applications with reactivity to human samples 66543-1-Ig targets SIRT4 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, NCCIT cell, PC-3 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:20000-1:80000 Background Information SIRT4, also named as NAD-dependent protein lipoamidase sirtuin-4, mitochondria, is a 314 amino acid protein, which belongs to the sirtuin family. Class II subfamily. SIRT4 is detected in vascular smooth muscle and striated muscle. SIRT4 is detected in insulin-producing beta-cells in pancreas islets of Langerhans. SIRT4 Acts as NAD-dependent protein lipoamidase, ADP-ribosyl transferase and deacetylase. It catalyzes more efficiently removal of lipoyl- and biotinyl- than acetyl-lysine modifications and inhibits the pyruvate dehydrogenase complex (PDH) activity via the enzymatic hydrolysis of the lipoamide cofactor from the E2 component, DLAT, in a phosphorylation-independent manner. SIRT4 expression is down-regulated in a number of cancers, while overexpression reduces cell proliferation, transformation, and tumor development. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17347 Product name: Recombinant human SIRT4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-314 aa of BC109319 Sequence: MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC Predict reactive species Full Name: sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) Calculated Molecular Weight: 314 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC109319 Gene Symbol: SIRT4 Gene ID (NCBI): 23409 RRID: AB_2881905 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y6E7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.