Iright
BRAND / VENDOR: Proteintech

Proteintech, 66545-1-Ig, STAT1 Monoclonal antibody

CATALOG NUMBER: 66545-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The STAT1 (66545-1-Ig) by Proteintech is a Monoclonal antibody targeting STAT1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66545-1-Ig targets STAT1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, NIH/3T3 cells, HeLa cells, MCF-7 cells, Jurkat cells, HSC-T6 cells Positive IHC detected in: human ovary tumor tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: IFN alpha treated HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information What is the molecular weight of STAT1? Are there any isoforms of STAT1? Is STAT1 post-translationally modified?The molecular weight of STAT1 is 91 kDa for full-length STAT1α and 84 kDa for STAT1β, which is devoid of the C-terminal activation domain (PMID: 1502203). Phosphorylation of STAT1 regulates STAT1 activity. Phosphorylation of Tyr701 by Janus kinases (JAKs) triggers STAT1 homo- and hetero-dimerization with other STAT family members and also causes nuclear translocation, while phosphorylation of Ser727 is needed for full activation (PMID: 10851062). STAT1β lacks Ser727 and has therefore been considered to be inactive or acting in a dominant negative manner to STAT1α, although it has been further shown to be capable of transcription activation in vivo (PMID: 24710278).What is the subcellular localization of STAT1?STAT1 is present in the cytoplasm and in the nucleus. Translocation of STAT1 from the cytoplasm to the nucleus is required for its regulation of gene expression and is dependent on phosphorylation (see above). However, low levels of unphosphorylated STAT1, often referred to as U-STAT1, can also be found in the nucleus, where U-STAT1 regulates the stability of heterochromatin by binding to chromatin in monomeric or dimeric states (PMID: 18840523).What is the tissue expression pattern of STAT1?STAT1 is ubiquitously expressed. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0199 Product name: Recombinant human STAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-230 aa of BC002704 Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA Predict reactive species Full Name: signal transducer and activator of transcription 1, 91kDa Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 84 kDa GenBank Accession Number: BC002704 Gene Symbol: STAT1 Gene ID (NCBI): 6772 RRID: AB_2881907 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P42224 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924