Proteintech, 66547-1-Ig, COX4NB Monoclonal antibody

Size: 20ul / 150ul The COX4NB (66547-1-Ig) by Proteintech is a Monoclonal antibody targeting COX4NB in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 66547-1-Ig targets COX4NB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13776 Product name: Recombinant human COX4NB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-210 aa of BC001472 Sequence: MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC Predict reactive species Full Name: COX4 neighbor Calculated Molecular Weight: 210 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC001472 Gene Symbol: COX4NB Gene ID (NCBI): 10328 RRID: AB_2881909 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43402 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.