Proteintech, 66554-1-Ig, Serpin F1/PEDF Monoclonal antibody

Size: 20ul / 150ul The Serpin F1/PEDF (66554-1-Ig) by Proteintech is a Monoclonal antibody targeting Serpin F1/PEDF in WB, ELISA applications with reactivity to human, pig samples 66554-1-Ig targets Serpin F1/PEDF in WB, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: human plasma tissue, pig plasma tissue, human blood tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information PEDF also known as serpin F1 (SERPINF1), is a multifunctional secreted protein that has anti-angiogenic, anti-tumorigenic, and neurotrophic functionsis. It is an approximately 50-kDa secreted protein that is widely expressed, including by osteoblasts and osteoclasts. PEDF is also one of the most abundant secretory products of adipocytes, and circulating concentrations of PEDF correlate positively with body fat mass and INS resistance. PEDF is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells. Mutations in this gene were found in individuals with osteogenesis imperfecta, type VI. Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26660 Product name: Recombinant human SERPINF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 282-403 aa of BC013984 Sequence: VTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDT Predict reactive species Full Name: serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 Calculated Molecular Weight: 418 aa, 46 kDa Observed Molecular Weight: 46-50 kDa GenBank Accession Number: BC013984 Gene Symbol: PEDF Gene ID (NCBI): 5176 RRID: AB_2881916 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P36955 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.