Iright
BRAND / VENDOR: Proteintech

Proteintech, 66557-1-Ig, HE4 Monoclonal antibody

CATALOG NUMBER: 66557-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HE4 (66557-1-Ig) by Proteintech is a Monoclonal antibody targeting HE4 in IHC, IF/ICC, ELISA applications with reactivity to human samples 66557-1-Ig targets HE4 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SKOV-3 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:5000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information WFDC2, also named as HE4, is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. HE4 is expressed in a number of normal tissues, and it is also highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. In some study, HE4 was referred to as a biomarker for ovarian carcinoma. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5936 Product name: Recombinant human HE4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-124 aa of BC046106 Sequence: GFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF Predict reactive species Full Name: WAP four-disulfide core domain 2 Calculated Molecular Weight: 13 kDa GenBank Accession Number: BC046106 Gene Symbol: HE4 Gene ID (NCBI): 10406 RRID: AB_2881918 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14508 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924