Proteintech, 66561-1-Ig, SMARCA4/BRG1 Monoclonal antibody

Size: 20ul / 150ul The SMARCA4/BRG1 (66561-1-Ig) by Proteintech is a Monoclonal antibody targeting SMARCA4/BRG1 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 66561-1-Ig targets SMARCA4/BRG1 in WB, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, COLO 320 cells, HeLa cells, Jurkat cells, K-562 cells, HSC-T6 cells, 4T1 cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HepG2 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16256 Product name: Recombinant human SMARCA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-298 aa of BC150298 Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST Predict reactive species Full Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 Calculated Molecular Weight: 1647 aa, 185 kDa Observed Molecular Weight: 185 kDa GenBank Accession Number: BC150298 Gene Symbol: SMARCA4 Gene ID (NCBI): 6597 RRID: AB_2881922 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P51532 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.