Iright
BRAND / VENDOR: Proteintech

Proteintech, 66566-1-Ig, Geminin Monoclonal antibody

CATALOG NUMBER: 66566-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Geminin (66566-1-Ig) by Proteintech is a Monoclonal antibody targeting Geminin in WB, IHC, ELISA applications with reactivity to human samples 66566-1-Ig targets Geminin in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells, HEK-293 cells, NCCIT cells, Jurkat cells Positive IHC detected in: human colon cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information GMNN, also designated geminin, contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). GMNN participates in ininhibiting DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC). It is degraded during the metaphase-anaphase transition of cell cycle's mitotic phase, which permits replication in the succeeding cell cycle. GMNN has a broad sedimentation profile ranging from about 25 kDa to 90 kDa, with a major peak at 30 kDa. Scanning of the signals shows that discrete peaks corresponding to apparent mass of 42.5 kDa and 66 kDa are present. (PMID: 15313623) Specification Tested Reactivity: human Cited Reactivity: rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24283 Product name: Recombinant human GMNN protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-209 aa of BC005185 Sequence: MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI Predict reactive species Full Name: geminin, DNA replication inhibitor Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC005185 Gene Symbol: GMNN Gene ID (NCBI): 51053 RRID: AB_2881927 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75496 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924