Proteintech, 66575-1-Ig, KAT2A/GCN5 Monoclonal antibody

Size: 20ul / 150ul The KAT2A/GCN5 (66575-1-Ig) by Proteintech is a Monoclonal antibody targeting KAT2A/GCN5 in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 66575-1-Ig targets KAT2A/GCN5 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, HSC-T6 cells, NIH/3T3 cells, SKOV-3 cells Positive IF/ICC detected in: SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GCN5, encoded by KAT2A, is a member of nuclear A-type histone acetyltransferase (HAT) which has direct impact on gene transcription. Additionally, GCN5 has roles in cell cycle regulation, DNA replication, and DNA repair, highlighting it as key player in the maintenance of genome stability. GCN5 is a coactivator of c-MYC oncogene protein and has oncogenic roles in various cancers. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6940 Product name: Recombinant human KAT2A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 537-837 aa of BC032743 Sequence: EYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK Predict reactive species Full Name: K(lysine) acetyltransferase 2A Calculated Molecular Weight: 94 kDa Observed Molecular Weight: 94 kDa GenBank Accession Number: BC032743 Gene Symbol: KAT2A Gene ID (NCBI): 2648 RRID: AB_2881935 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.