Proteintech, 66578-1-Ig, GTDC1 Monoclonal antibody

Size: 20ul / 150ul The GTDC1 (66578-1-Ig) by Proteintech is a Monoclonal antibody targeting GTDC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, pig samples 66578-1-Ig targets GTDC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, pig samples. Tested Applications Positive WB detected in: human cerebellum tissue, pig brain tissue, pig cerebellum tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: Human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9934 Product name: Recombinant human GTDC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-292 aa of BC061699 Sequence: MSILIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTIPISEHYRTLFASSVLNLTELAALRPDLGKLKKILYFHENQLIYPVKKCQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRFMPKHKTTHLKKMLGLKGNGGAVLSMALPFQPEQRDSEDLLKNFNSECDTHCGLDTARQEYLGNSLRQESDLKKSTSSDNSSSHHGENKQNLTVDPCDILGGVDNQQRLLHIVWPHRW Predict reactive species Full Name: glycosyltransferase-like domain containing 1 Calculated Molecular Weight: 292 aa, 34 kDa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC061699 Gene Symbol: GTDC1 Gene ID (NCBI): 79712 RRID: AB_2881938 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q4AE62 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.