Iright
BRAND / VENDOR: Proteintech

Proteintech, 66579-1-Ig, AMPK Beta 2 Monoclonal antibody

CATALOG NUMBER: 66579-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AMPK Beta 2 (66579-1-Ig) by Proteintech is a Monoclonal antibody targeting AMPK Beta 2 in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 66579-1-Ig targets AMPK Beta 2 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, A431 cells, HeLa cells, A549 cells, human brain tissue, rat brain tissue, mouse brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information AMPK beta 2 is a regulatory subunit of the AMP-activated protein kinase (AMPK), which is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK beta 2 may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5806 Product name: Recombinant human PRKAB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC053610 Sequence: MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI Predict reactive species Full Name: protein kinase, AMP-activated, beta 2 non-catalytic subunit Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC053610 Gene Symbol: AMPK Beta 2 Gene ID (NCBI): 5565 RRID: AB_2881939 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43741 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924