Product Description
Size: 20ul / 150ul
The OPA1 (66583-1-Ig) by Proteintech is a Monoclonal antibody targeting OPA1 in WB, IHC, ELISA applications with reactivity to Human, mouse, pig, rat samples
66583-1-Ig targets OPA1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse, pig, rat samples.
Tested Applications
Positive WB detected in: HEK-293 cells, pig brain tissue, HeLa cells, HepG2 cells, Y79 cells, mouse brain tissue, rat brain tissue
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:400-1:1600
Background Information
OPA1 is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. OPA1 localizes to the inner mitochondrial membrane and helps regulate mitochondrial stability and energy output. This protein also sequesters cytochrome c. OPA1 is associated with the inner membrane and protects cells from apoptosis by regulating inner membrane dynamics. Mutation of OPA1 causes the disease dominant optic atrophy, a degeneration of the retinal ganglion cells. OPA1 undergoes complex posttranscriptional regulation and posttranslational proteolysis. OPA1 is regulated by proteolytic cleavage, which degrades long OPA1 isoforms into short isoforms. The gene OPA1 can be cleaved into some chains with MW 100 kDa and 80-90 kDa.
Specification
Tested Reactivity: Human, mouse, pig, rat
Cited Reactivity: human, mouse, rat, fish
Host / Isotype: Mouse / IgG2b
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag26868 Product name: Recombinant human OPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 650-780 aa of BC075805 Sequence: NTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKN Predict reactive species
Full Name: optic atrophy 1 (autosomal dominant)
Calculated Molecular Weight: 960 aa, 112 kDa
Observed Molecular Weight: 100 kDa and 80-90 kDa
GenBank Accession Number: BC075805
Gene Symbol: OPA1
Gene ID (NCBI): 4976
RRID: AB_2881943
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: O60313
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924