Proteintech, 66583-1-Ig, OPA1 Monoclonal antibody

Size: 20ul / 150ul The OPA1 (66583-1-Ig) by Proteintech is a Monoclonal antibody targeting OPA1 in WB, IHC, ELISA applications with reactivity to Human, mouse, pig, rat samples 66583-1-Ig targets OPA1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse, pig, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, pig brain tissue, HeLa cells, HepG2 cells, Y79 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information OPA1 is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. OPA1 localizes to the inner mitochondrial membrane and helps regulate mitochondrial stability and energy output. This protein also sequesters cytochrome c. OPA1 is associated with the inner membrane and protects cells from apoptosis by regulating inner membrane dynamics. Mutation of OPA1 causes the disease dominant optic atrophy, a degeneration of the retinal ganglion cells. OPA1 undergoes complex posttranscriptional regulation and posttranslational proteolysis. OPA1 is regulated by proteolytic cleavage, which degrades long OPA1 isoforms into short isoforms. The gene OPA1 can be cleaved into some chains with MW 100 kDa and 80-90 kDa. Specification Tested Reactivity: Human, mouse, pig, rat Cited Reactivity: human, mouse, rat, fish Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26868 Product name: Recombinant human OPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 650-780 aa of BC075805 Sequence: NTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKN Predict reactive species Full Name: optic atrophy 1 (autosomal dominant) Calculated Molecular Weight: 960 aa, 112 kDa Observed Molecular Weight: 100 kDa and 80-90 kDa GenBank Accession Number: BC075805 Gene Symbol: OPA1 Gene ID (NCBI): 4976 RRID: AB_2881943 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60313 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.