Product Description
Size: 20ul / 150ul
The CHCHD5 (66584-1-Ig) by Proteintech is a Monoclonal antibody targeting CHCHD5 in WB, IHC, ELISA applications with reactivity to Human samples
66584-1-Ig targets CHCHD5 in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Applications
Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells, THP-1 cells, HL-60 cells
Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunohistochemistry (IHC): IHC : 1:150-1:600
Specification
Tested Reactivity: Human
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag22534 Product name: Recombinant human CHCHD5 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-110 aa of BC004498 Sequence: MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS Predict reactive species
Full Name: coiled-coil-helix-coiled-coil-helix domain containing 5
Calculated Molecular Weight: 110 aa, 12 kDa
Observed Molecular Weight: 14 kDa
GenBank Accession Number: BC004498
Gene Symbol: CHCHD5
Gene ID (NCBI): 84269
RRID: AB_2881944
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: Q9BSY4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924