Proteintech, 66595-1-Ig, MRPL23 Monoclonal antibody

Size: 20ul / 150ul The MRPL23 (66595-1-Ig) by Proteintech is a Monoclonal antibody targeting MRPL23 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 66595-1-Ig targets MRPL23 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2220 Product name: Recombinant human MRPL23 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-153 aa of BC027710 Sequence: MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL Predict reactive species Full Name: mitochondrial ribosomal protein L23 Calculated Molecular Weight: 153 aa, 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC027710 Gene Symbol: MRPL23 Gene ID (NCBI): 6150 RRID: AB_2881955 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16540 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.