Proteintech, 66600-1-Ig, ATPB Monoclonal antibody

Size: 20ul / 150ul The ATPB (66600-1-Ig) by Proteintech is a Monoclonal antibody targeting ATPB in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66600-1-Ig targets ATPB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSCT6 cells, Raw 264.7 cells, NIH/3T3 cells Positive IHC detected in: human liver tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information ATP5B, also named as ATPMB and ATPSB, belongs to the ATPase alpha/beta chains family. It is a high affinity HDL receptor for apolipoprotein A1. ATP5B is a subunit of mitochondrial ATP synthase (F1F0 ATP synthase or Complex V ). ATP5B has a calculated molecular mass of 57 kDa and ~5 kDa transit peptide can be removed in the mature form. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11177 Product name: Recombinant human ATPB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-529 aa of BC016512 Sequence: EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS Predict reactive species Full Name: ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide Calculated Molecular Weight: 529 aa, 57 kDa Observed Molecular Weight: 45-57 kDa GenBank Accession Number: BC016512 Gene Symbol: ATPB Gene ID (NCBI): 506 RRID: AB_2881960 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P06576 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.