Iright
BRAND / VENDOR: Proteintech

Proteintech, 66602-1-Ig, AGXT2 Monoclonal antibody

CATALOG NUMBER: 66602-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AGXT2 (66602-1-Ig) by Proteintech is a Monoclonal antibody targeting AGXT2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 66602-1-Ig targets AGXT2 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, NIH/3T3 cells, HEK-293 cells, HepG2 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26888 Product name: Recombinant human AGXT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 201-300 aa of NM_001306173 Sequence: MSPYTLGLTNVGTYKMELPGGTGCQPTMCPDVFRGPWGGSHCRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPK Predict reactive species Full Name: alanine-glyoxylate aminotransferase 2 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: NM_001306173 Gene Symbol: AGXT2 Gene ID (NCBI): 64902 RRID: AB_2881962 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BYV1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924