Proteintech, 66609-1-Ig, MMACHC Monoclonal antibody

Size: 20ul / 150ul The MMACHC (66609-1-Ig) by Proteintech is a Monoclonal antibody targeting MMACHC in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 66609-1-Ig targets MMACHC in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, HEK-293 cells, HeLa cells, Raji cells, RAW 264.7 cells Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information MMACHC, also named as CblC, is located on chromosome 1 and comprises four coding exons. Human MMACHC catalyzes the reductive decyanation of cyanocobalamin and may serve as a trafficking chaperone for intracellular cobalamin. It also catalyzes the glutathione-dependent reductive demethylation of methylcobalamin, and, with much lower efficiency, the glutathione-dependent reductive demethylation of adenosylcobalamin. NMACHC binds cyanocobalamin, adenosylcobalamin, methylcobalamin and other, related vitamin B12 derivatives. Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15001 Product name: Recombinant human MMACHC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-225 aa of BC006122 Sequence: MFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP Predict reactive species Full Name: methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria Calculated Molecular Weight: 282 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC006122 Gene Symbol: MMACHC Gene ID (NCBI): 25974 RRID: AB_2881969 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y4U1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.