Proteintech, 66611-1-Ig, CCRL2 Monoclonal antibody

Size: 20ul / 150ul The CCRL2 (66611-1-Ig) by Proteintech is a Monoclonal antibody targeting CCRL2 in WB, IHC, ELISA applications with reactivity to Human samples 66611-1-Ig targets CCRL2 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells Positive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information Chemokine CC motif receptor-like 2 (CCRL2) is a seven-transmembrane domain receptor that shares structural and functional similarities with the family of atypical chemokine receptors (ACKRs) (PMID: 28743719). CCRL2 does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. CCRL2 has been found on almost all hemopoietic cells, including monocytes, macrophages, polymorphonuclear neutrophils (PMNs), T cells, dendritic cells, natural killer cells, and CD34+ progenitor cells, with PMNs expressing the highest levels (PMID: 15188357). CCRL2 is also expressed by barrier cells, such as lymphatic and blood endothelial cells and bronchial and intestinal epithelial cells (PMID: 29056935). Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4045 Product name: Recombinant human CCRL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-344 aa of BC025717 Sequence: MWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV Predict reactive species Full Name: chemokine (C-C motif) receptor-like 2 Calculated Molecular Weight: 344 aa, 40 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC025717 Gene Symbol: CCRL2 Gene ID (NCBI): 9034 RRID: AB_2881971 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O00421 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.