Proteintech, 66626-1-Ig, cIAP1 Monoclonal antibody

Size: 20ul / 150ul The cIAP1 (66626-1-Ig) by Proteintech is a Monoclonal antibody targeting cIAP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 66626-1-Ig targets cIAP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, HepG2 cells, Hela cells, Jurkat cells, HSCT6 cells, pig brain tissue, rat brain tissue, mouse skeletal muscle tissue Positive IHC detected in: human spleen tissue, human tonsillitis tissue, human lung cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information BIRC2 (also known as cIAP1) is a member of the inhibitor of apoptosis protein (IAP) family. The inhibitor of apoptosis (IAP) proteins are a family of anti-apoptotic regulators found in viruses and metazoans. BIRC2 is a nuclear shuttling protein, whose subcellular localization is mediated by the CRM1-dependent nuclear export pathway (PMID: 15265700). The protein is regulated transcriptionally and can be inhibited by mitochondrial proteins released in the cytoplasm upon apoptotic stimuli (PMID: 15187025). BIRC2 is also believed to be a critical regulator of vascular integrity and endothelial cell survival, thereby providing an additional target pathway for the control of angiogenesis and blood vessel homeostasis during embryogenesis, regeneration and tumorigenesis (PMID: 17934460). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21398 Product name: Recombinant human cIAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 95-196 aa of BC016174 Sequence: LGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPL Predict reactive species Full Name: baculoviral IAP repeat-containing 2 Calculated Molecular Weight: 618 aa, 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC016174 Gene Symbol: cIAP1 Gene ID (NCBI): 329 RRID: AB_2881986 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13490 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.