Proteintech, 66635-1-Ig, FIS1 Monoclonal antibody

Size: 20ul / 150ul The FIS1 (66635-1-Ig) by Proteintech is a Monoclonal antibody targeting FIS1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 66635-1-Ig targets FIS1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, HeLa cells, MCF-7 cells, Jurkat cells, HepG2 cells, K-562 cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Fis1 (fission 1) is an integral mitochondrial outer membrane protein that participates in mitochondrial fission by interacting with dynamin-related protein 1 (Drp1). Excessive mitochondrial fission is associated with the pathology of a number of neurodegenerative or neurodevelopmental diseases. Increased expression of Fis1 has been found in Huntington's disease (HD)-affected brain, Alzheimer's disease (AD) patients, and autism spectrum disorder. (21257639, 21459773, 23333625) Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig, goat, fish Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1409 Product name: Recombinant human FIS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC009428 Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS Predict reactive species Full Name: fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC009428 Gene Symbol: FIS1 Gene ID (NCBI): 51024 RRID: AB_2881994 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y3D6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.