Iright
BRAND / VENDOR: Proteintech

Proteintech, 66641-1-Ig, ANGPTL8/Betatrophin Monoclonal antibody

CATALOG NUMBER: 66641-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ANGPTL8/Betatrophin (66641-1-Ig) by Proteintech is a Monoclonal antibody targeting ANGPTL8/Betatrophin in WB, IHC, IF-P, ELISA applications with reactivity to Human samples 66641-1-Ig targets ANGPTL8/Betatrophin in WB, IHC, IF-P, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human adipose tissue Positive IHC detected in: human liver tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20708 Product name: Recombinant human LOC55908 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 117-251 aa of BC146552 Sequence: RNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA Predict reactive species Full Name: hepatocellular carcinoma-associated gene TD26 Calculated Molecular Weight: 251 aa, 28 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC146552 Gene Symbol: ANGPTL8 Gene ID (NCBI): 55908 RRID: AB_2882000 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q6UXH0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924