Product Description
Size: 20ul / 150ul
The ANGPTL8/Betatrophin (66641-1-Ig) by Proteintech is a Monoclonal antibody targeting ANGPTL8/Betatrophin in WB, IHC, IF-P, ELISA applications with reactivity to Human samples
66641-1-Ig targets ANGPTL8/Betatrophin in WB, IHC, IF-P, ELISA applications and shows reactivity with Human samples.
Tested Applications
Positive WB detected in: human adipose tissue
Positive IHC detected in: human liver tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: human liver tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Immunofluorescence (IF)-P: IF-P : 1:200-1:800
Specification
Tested Reactivity: Human
Cited Reactivity: human
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag20708 Product name: Recombinant human LOC55908 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 117-251 aa of BC146552 Sequence: RNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA Predict reactive species
Full Name: hepatocellular carcinoma-associated gene TD26
Calculated Molecular Weight: 251 aa, 28 kDa
Observed Molecular Weight: 22 kDa
GenBank Accession Number: BC146552
Gene Symbol: ANGPTL8
Gene ID (NCBI): 55908
RRID: AB_2882000
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: Q6UXH0
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924