Proteintech, 66649-1-Ig, CEBPB Monoclonal antibody

Size: 20ul / 150ul The CEBPB (66649-1-Ig) by Proteintech is a Monoclonal antibody targeting CEBPB in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 66649-1-Ig targets CEBPB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells, HepG2 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information CCAAT/enhancer-binding protein beta (CEBPB), also known as LAP, is a important transcriptional activator in the regulation of genes involved in immune and inflammatory responses. It specifically binds to an IL-1 response element in the IL-6 gene. NF-IL6 also binds to regulatory regions of several acute-phase and cytokines genes. It probably plays a role in the regulation of acute-phase reaction, inflammation and hemopoiesis. The consensus recognition site is 5'-T[TG]NNGNAA[TG]-3'. Functions in brown adipose tissue (BAT) differentiation By similarity. Regulates the transcriptional induction of peroxisome proliferator-activated receptor gamma (PPARG). CEBPb mRNAs possess alternative translation-initiation codons, which result in the formation of truncated forms of the protein. All major isoforms of CEBPB (38, 34, and 20 kDa) are expressed, with the 34 and 20kDa isoforms being more abundant in preovulatory follicles and further increased in corpora lutea (CL)(PMID:15647458).The truncated protein of 18 kDa (relative to the 30 kDa full-length protein that is known as LAP, or p30 CEBPb or liver-activating protein) lacks a transactivation domain,also known as LIP (p19 CEBPb or liver-inhibitory protein), can form homodimers or heterodimerize with other family members and, as it lacks the transactivation domain, can attenuate the transcriptional activation properties of the other isoforms.(10051447). Three variants of CEBPBs have been detected in many cell types: a 46 kDa full-length liver-enriched transcription-activating protein (LAP1), a 42 kDa LAP2 and a 20-kDa liver-enriched transcription-inhibitory protein (LIP). These variants are the result of an alternative translation initiation due to a leaky ribosomal scanning mechanism.(PMID:18820298). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20073 Product name: Recombinant human CEBPB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC007538 Sequence: MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKT Predict reactive species Full Name: CCAAT/enhancer binding protein (C/EBP), beta Calculated Molecular Weight: 345 aa, 36 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC007538 Gene Symbol: CEBPB Gene ID (NCBI): 1051 RRID: AB_2882006 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P17676 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.