Iright
BRAND / VENDOR: Proteintech

Proteintech, 66654-1-Ig, RAB43 Monoclonal antibody

CATALOG NUMBER: 66654-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RAB43 (66654-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB43 in WB, ELISA applications with reactivity to human samples 66654-1-Ig targets RAB43 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, HEK-293 cells, human brain tissue, Jurkat cells, HepG2 cells, L02 cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Ras-related GTP-binding protein 43 (RAB43) is a member of the Ras superfamily. RAB43 is mainly located in endoplasmic reticulum and Golgi, and plays a role as a key regulator of vesicle movement, signal transduction and tethering membrane events in membrane trafficking. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26911 Product name: Recombinant human RAB43 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 91-212 aa of BC062319 Sequence: ANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC Predict reactive species Full Name: RAB43, member RAS oncogene family Calculated Molecular Weight: 212 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC062319 Gene Symbol: RAB43 Gene ID (NCBI): 339122 RRID: AB_2882011 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q86YS6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924