Iright
BRAND / VENDOR: Proteintech

Proteintech, 66657-1-Ig, ETV5 Monoclonal antibody

CATALOG NUMBER: 66657-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ETV5 (66657-1-Ig) by Proteintech is a Monoclonal antibody targeting ETV5 in WB, ELISA applications with reactivity to Human samples 66657-1-Ig targets ETV5 in WB, chIP, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: T-47D cells, HeLa cells, PC-3 cells, DU 145 cells, LNCaP cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ETS variant gene 5(ETV5) belongs to the ETS oncogene family that shares a conserved peptide, ETS domain, which mediates sequence-specific DNA binding. ETV5 is a transcription factor and is required for spermatogonial stem cell self-renewal. ETV5 can be negatively regulated by COP1, a tumor suppressor. Also it has a role in branching morphogenesis in the developing kidney Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3708 Product name: Recombinant human ETV5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-510 aa of BC007333 Sequence: SGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSPAYLLDMDRCSSLPYAEGFAY Predict reactive species Full Name: ets variant 5 Calculated Molecular Weight: 510 aa, 58 kDa Observed Molecular Weight: 58-60 kDa GenBank Accession Number: BC007333 Gene Symbol: ETV5 Gene ID (NCBI): 2119 RRID: AB_2882014 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P41161 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924