Iright
BRAND / VENDOR: Proteintech

Proteintech, 66659-1-Ig, POU2AF1 Monoclonal antibody

CATALOG NUMBER: 66659-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The POU2AF1 (66659-1-Ig) by Proteintech is a Monoclonal antibody targeting POU2AF1 in WB, IHC, ELISA applications with reactivity to human samples 66659-1-Ig targets POU2AF1 in WB, IHC, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, Ramos cells, Daudi cells Positive IHC detected in: Human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:850-1:3400 Background Information POU2AF1, also named as BOB-1 or OCA-B, is a 256 amino acid protein, which belongs to the POU2AF1 family. POU2AF1 is expressed in B-cell specific. POU2AF1 as a transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of OCT1 and OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers.The predicted size of this protein is 27 kDa. Studies have reported that the protein has a multi-band size of 34-35 kDa through siRNA interference experiments (PMID: 17621271). This result is the same as our experiments. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag23613 Product name: Recombinant human POU2AF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-256 aa of BC032549 Sequence: MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF Predict reactive species Full Name: POU class 2 associating factor 1 Calculated Molecular Weight: 256 aa, 27 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC032549 Gene Symbol: POU2AF1 Gene ID (NCBI): 5450 ENSEMBL Gene ID: ENSG00000110777 RRID: AB_2882016 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q16633 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924