Proteintech, 66677-1-Ig, AKR7A2 Monoclonal antibody

Size: 20ul / 150ul The AKR7A2 (66677-1-Ig) by Proteintech is a Monoclonal antibody targeting AKR7A2 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 66677-1-Ig targets AKR7A2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information AKR7A2(Aflatoxin B1 aldehyde reductase member 2) is also named as AFAR, AFAR1, AKR7 and belongs to the aldo/keto reductase family. AKR7A2 enzyme is catalytically active toward aldehydes arising from lipid peroxidation, suggesting a potential role against the consequences of oxidative stress, and representing an important detoxication route in mammalian cells(PMID:22001351). Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26105 Product name: Recombinant human AKR7A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 60-359 aa of BC007352 Sequence: RAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR Predict reactive species Full Name: aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC007352 Gene Symbol: AKR7A2 Gene ID (NCBI): 8574 RRID: AB_2882031 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43488 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.