Proteintech, 66678-1-Ig, PSMA/GCPII Monoclonal antibody

Size: 20ul / 150ul The PSMA/GCPII (66678-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMA/GCPII in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 66678-1-Ig targets PSMA/GCPII in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat kidney tissue, LNCaP cells, mouse kidney tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: human prostate cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human prostate cancer tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information PSMA(Prostate-specific membrane antigen) is also named as FOLH1, FOLH, NAALAD1, PSM and belongs to the peptidase M28 family. PSMA is a 100-120 kDa integral transmembrane glycoprotein, considered to be a highly specific marker of the prostate gland, and has successfully been used as a marker of circulating prostatic epithelial cells(PMID:10074909; 15680901). It is involved in conversion of the major neurotransmitter (NAAG) to NAA and free glutamate. It has 8 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16594 Product name: Recombinant human FOLH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 45-385 aa of BC025672 Sequence: SSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGG Predict reactive species Full Name: folate hydrolase (prostate-specific membrane antigen) 1 Calculated Molecular Weight: 719 aa, 81 kDa Observed Molecular Weight: 100-120 kDa GenBank Accession Number: BC025672 Gene Symbol: PSMA Gene ID (NCBI): 2346 RRID: AB_2882032 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q04609 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.