Proteintech, 66683-1-Ig, Betacellulin Monoclonal antibody

Size: 20ul / 150ul The Betacellulin (66683-1-Ig) by Proteintech is a Monoclonal antibody targeting Betacellulin in WB, ELISA applications with reactivity to human samples 66683-1-Ig targets Betacellulin in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, NCCIT cells, A549 cells, MDA-MB-231 cells, T-47D cells, PC-3 cells, BxPC-3 cells, DU 145 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:10000 Background Information Betacellulin (BTC), a member of the epidermal growth factor (EGF) family, binds and activates ErbB1 and ErbB4 homodimers. BTC is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. BTC was expressed in tumors and involved in tumor growth progression. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26724 Product name: Recombinant human BTC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-118 aa of BC011618 Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ Predict reactive species Full Name: betacellulin Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC011618 Gene Symbol: BTC Gene ID (NCBI): 685 RRID: AB_2882037 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P35070 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.