Proteintech, 66693-1-Ig, CALD1 Monoclonal antibody

Size: 20ul / 150ul The CALD1 (66693-1-Ig) by Proteintech is a Monoclonal antibody targeting CALD1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 66693-1-Ig targets CALD1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NCI-H1299 cells, HeLa cells, U2OS cells, HepG2 cells, PC-3 cells, SKOV-3 cells, A2780 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, Calu-1 cells, Caco-2 cells, Caki-1 cells, MCF-10A cells, LNCaP cells, SK-N-SH cells Positive IHC detected in: human colon cancer tissue, human colon tissue, human hysteromyoma tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13676 Product name: Recombinant human CALD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 196-538 aa of BC040354 Sequence: EKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV Predict reactive species Full Name: caldesmon 1 Calculated Molecular Weight: 538 aa, 63 kDa Observed Molecular Weight: 70 kDa~75 kDa GenBank Accession Number: BC040354 Gene Symbol: CALD1 Gene ID (NCBI): 800 RRID: AB_2882047 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q05682 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.