Proteintech, 66703-1-Ig, THRA Monoclonal antibody

Size: 20ul / 150ul The THRA (66703-1-Ig) by Proteintech is a Monoclonal antibody targeting THRA in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66703-1-Ig targets THRA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells Positive IHC detected in: mouse brain tissue, human thyroid cancer tissue, mouse heart tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:650-1:2600 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27189 Product name: Recombinant human THRA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 44-282 aa of BC002728 Sequence: PSYLDKDEQCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAV Predict reactive species Full Name: thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian) Calculated Molecular Weight: 490 aa, 54 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC002728 Gene Symbol: THRA Gene ID (NCBI): 7067 RRID: AB_3085032 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P10827 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.